PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr012085.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 635aa    MW: 69689.6 Da    PI: 5.1674
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr012085.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS445.82.9e-1362666251374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  lv+ L++cAeav++++++la+al++++  la +++ +m+++a++f+eALa+r+++    +y    p++    ++s + + +  f+e++P+lkf+h+ta
  Pbr012085.1 266 LVHGLMACAEAVQQNNFNLAKALVTQIGYLAGSQAGAMRKVATFFAEALAQRIFQ----VY----PQSPI--DHSFSDMLQMHFYETCPYLKFAHFTA 353
                  6899**************************************************9....44....33332..23444445556*************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  NqaIle+++g++rvH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+s++++ l+e+g++La++Ae+++v+fe++ +va++l+dl+ ++L++
  Pbr012085.1 354 NQAILESLQGKTRVHVIDFSMNQGMQWPALMQALALRPGGPPAFRLTGIGPPASDNSDHLQEVGWKLAQLAETIHVEFEYRGFVANSLADLDASMLEL 451
                  ************************************************************************************************** PP

         GRAS 197 kp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  +p   E++aVn+v++lh+ll++++++e+    vL++vk+++P++v+vveqea+hn++ F++rf e+l+yys+lfdsle +   +++ ++++++++lg+
  Pbr012085.1 452 RPseVESVAVNSVFELHKLLARPGAIEK----VLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEGS---ANSRDKVMSEVYLGK 542
                  **88899*********************....**********************************************99...58999999******* PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +i+nvvaceg +r+erhetl +Wr+r+++a F pv+l+++a kqa++ll+ ++ +dgyrvee++g+++l W++rpL+++SaW+
  Pbr012085.1 543 QICNVVACEGVDRVERHETLTQWRARFGSADFVPVHLGSNAFKQASMLLALFAgGDGYRVEENDGCMMLAWHTRPLIATSAWK 625
                  **********************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011291.4E-3450123No hitNo description
PfamPF120412.2E-3550117IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098566.224240604IPR005202Transcription factor GRAS
PfamPF035141.0E-133266625IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 635 aa     Download sequence    Send to blast
MKGEHQTHQL NQYPPPQHPD PSMASTSAGG GFGKAKMWED ESHRIDGGMD ELLAVLGYKV  60
RSSDMAEVAQ KLEQLEEFMG CAQEDGLSQL ASDTVHYNPA DLSTWLESMI SEINLPPPNF  120
DPLMGGAVAG MQPNQQQVQL VDDPFLARGE SSITTVDFPD QRKSKSISTS PPQTVFEDCN  180
SSSSYYDFKS IPGNAVFTQT RLDSPSREPK RLKSSSGSSP SELLFNRPAA SSLPQPQQPI  240
SLPATAESSP TRPALIVDSQ ENGVRLVHGL MACAEAVQQN NFNLAKALVT QIGYLAGSQA  300
GAMRKVATFF AEALAQRIFQ VYPQSPIDHS FSDMLQMHFY ETCPYLKFAH FTANQAILES  360
LQGKTRVHVI DFSMNQGMQW PALMQALALR PGGPPAFRLT GIGPPASDNS DHLQEVGWKL  420
AQLAETIHVE FEYRGFVANS LADLDASMLE LRPSEVESVA VNSVFELHKL LARPGAIEKV  480
LSVVKQMKPE IVTVVEQEAN HNGPVFMDRF NESLHYYSTL FDSLEGSANS RDKVMSEVYL  540
GKQICNVVAC EGVDRVERHE TLTQWRARFG SADFVPVHLG SNAFKQASML LALFAGGDGY  600
RVEENDGCMM LAWHTRPLIA TSAWKPAYNS VMAH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-502666254375GRAS family transcription factor containing p
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF3041030.0JF304103.1 Pyrus x bretschneideri cultivar Yali DELLA protein mRNA, complete cds.
GenBankKU3110030.0KU311003.1 Pyrus pyrifolia cultivar mixueli DELLA protein GAI2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009351505.10.0PREDICTED: DELLA protein GAI-like
SwissprotQ6EI050.0GAIPB_CUCMA; DELLA protein GAIP-B
TrEMBLI1ZG120.0I1ZG12_9R
STRINGPOPTR_0008s13090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein